Invitrogen™ Human PIN1 (aa 104-163) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105456	100 μL

Catalog No. RP105456 Supplier Invitrogen™ Supplier No. RP105456

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PIN1 (Peptidylprolyl Cis/Trans Isomerase, NIMA-Interacting 1) is a Protein Coding gene. Diseases associated with PIN1 include Meibomian Cyst and Viral Exanthem. Among its related pathways are Transport of the SLBP independent Mature mRNA and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include peptidyl-prolyl cis-trans isomerase activity and mitogen-activated protein kinase binding.

Specifications

• Accession Number: Q13526
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5300
• Name: Human PIN1 (aa 104-163) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0610025L01Rik; D9Bwg1161e; DOD; EC 5.2.1.8; NIMA-interacting; peptidylprolyl cis/trans isomerase, NIMA-interacting 1; peptidylprolyl cis/trans isomerase, NIMA-interacting 1 a; peptidylprolyl cis/trans isomerase, NIMA-interacting 1 S homeolog; Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1; peptidyl-prolyl cis-trans isomerase Pin1; pin1; pin1.S; pin1a; pin1-a; pin1-b; PPIase Pin1; prolyl isomerase; prolyl isomerase Pin1; protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1; protein (peptidylprolyl cis/trans isomerase) NIMA-interacting 1; rotamase Pin1; ubl5; XELAEV_18021616mg
• Common Name: PIN1
• Gene Symbol: Pin1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining