Invitrogen™ Human PKA alpha (aa 77-125) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105523	100 μL

Catalog No. RP105523 Supplier Invitrogen™ Supplier No. RP105523

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein kinase A (PKA, cAMP-dependent protein kinase) is a key element of a ubiquitous signaling pathway important in the cell cycle, cellular communication, memory formation and behavior. PKA is composed of two catalytic (PKAc; Protein Kinase A catalytic subunit) and two regulatory subunits (PKAr). Upon binding cAMP, the complex dissociates to PKAr dimer and two activated PKAc ser/thr protein kinase catalytic monomers. The released PKAc can translocate into the nucleus and exert a regulatory role in the activation of multiple nuclear hormone receptors. However, PKAc-mediated activation of tonicity-dependent gene expression is cAMP independent. Humans express three types of PKAc subunit - PKAc alpha is present in most human tissues, PKAc beta and gamma are tissue-specific, the later is found in testes.

Specifications

• Accession Number: P17252
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5566
• Name: Human PKA alpha (aa 77-125) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: alternatively spliced; C(s); Calpha; C-alpha-2; C-alpha-S; cAMP-dependent protein kinase catalytic subunit alpha; cAMP-dependent protein kinase catalytic subunit alpha, isoform 1; cAMP-dependent protein kinase catalytic subunit C alpha; cAMP-dependent protein kinase catalytic subunit Calpha1; Cs-PKA; MGC102831; MGC48865; PKA; PKA C-alpha; PKA catalytic subunit alpha; pkac; Pkaca; PKCA1; PKCD; PPNAD4; PRKACA; protein kinase; protein kinase A; protein kinase A alpha; protein kinase A catalytic subunit; protein kinase cAMP-activated catalytic subunit alpha; protein kinase, cAMP dependent, catalytic, alpha; protein kinase, cAMP-dependent, alpha catalytic subunit; protein kinase, cAMP-dependent, catalytic, alpha; sperm cAMP-dependent protein kinase catalytic subunit; sperm cAMP-dependent protein kinase catalytic subunit Cs
• Common Name: PKA alpha
• Gene Symbol: PRKACA
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining