Invitrogen™ Human PKP2 (aa 72-194) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89628	100 μL

Catalog No. RP89628 Supplier Invitrogen™ Supplier No. RP89628

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53144. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plakophilins 1, 2, 3 and 4 (PKP1-4) influence development and participate in linking cadherins to cytoskeletal intermediate filaments. Plakophilins 1-4 contain arm-repeat (armadillo) domains and localize to nuclei and cell desmosomes (cell-cell junctions found in suprabasal layers of stratifying epithelia that undergo mechanical stress). Plakophilin 1 mediates increases in desmosomal protein content, desmosome assembly and regulation of cell migration. Plakophilin 2 is important for desmosome assembly and is an essential morphogenic factor and architectural component of the heart. Plakophilin 4 is a component of desmosomal adhesion plaques that regulates junctional plaque organization and cadherin function.

Specifications

• Accession Number: Q99959
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5318
• Name: Human PKP2 (aa 72-194) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1200008D14Rik; 1200012P04Rik; AA516617; ARVD9; PKP2; Pkp2l; plakophilin 2; plakophilin-2
• Common Name: PKP2
• Gene Symbol: PKP2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VGNGNLHRTSSVPEYVYNLHLVENDFVGGRSPVPKTYDMLKAGTTATYEGRWGRGTAQYSSQKSVEERSLRHPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPPRY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining