Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human PLAC9 (aa 24-97) Control Fragment Recombinant Protein

Catalog No. RP99992
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99992 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99992 Supplier Invitrogen™ Supplier No. RP99992
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60373. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

By microarray assay to search for mouse genes enriched in placenta, Plac9 was identified as a placenta-enriched gene expressed in mouse 16-cell morula cDNA. By database analysis, human PLAC9, which encodes a deduced 97-amino acid protein, was identified. The deduced 108-amino acid mouse protein has a predicted signal peptide, a coiled-coil domain, and shares 73% identity with human PLAC9. Northern blot analysis of mouse placenta and embryo RNA at 12.5 and 18.5 days postcoitum (dpc) detected predominant expression in placenta.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5JTB6
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 219348
Name Human PLAC9 (aa 24-97) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias hypothetical protein LOC510496; PLAC9; Plac9a; placenta associated 9; placenta specific 9; placenta specific 9a; placenta-specific 9; placenta-specific protein 9
Common Name PLAC9
Gene Symbol PLAC9
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.