Invitrogen™ Human PLCG1 (aa 1216-1286) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102733	100 μL

Catalog No. RP102733 Supplier Invitrogen™ Supplier No. RP102733

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83347. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mammalian Phospholipase Cg (PLCg) family has two closely related proteins, PLCg1 and PLCg2. The PLCg isozymes have the core structure domains and a unique array of domains containing an additional PH domain, two SH2 domains and one SH3 domain. In response to extracellular stimuli, such as hormones and growth factors, receptor tyrosine kinases (RTKs) phosphorylate and activate PLCg. Activated PLCg catalyzes hydrolysis of phosphatidylinositol 4,5-bisphosphate (PIP2) to produce the metabolic second messenger molecules inositol 1,4,5-triphosphate (IP3) and diacylglycerol (DAG).

Specifications

• Accession Number: P19174
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5335
• Name: Human PLCG1 (aa 1216-1286) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1-phosphatidyl-D-myo-inositol-4,5-bisphosphate; 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1; AI894140; Cded; cell differentiation and embryonic development; EC 3.1.4.11; inositoltrisphosphohydrolase; monophosphatidylinositol phosphodiesterase; NCKAP3; OTTHUMP00000178982; phosphatidylinositol phospholipase C; phosphoinositidase C; phosphoinositide phospholipase C; phosphoinositide phospholipase C-gamma-1; phospholipase C gamma 1; phospholipase C, gamma 1; phospholipase C, gamma 1 (formerly subtype 148); phospholipase C-1; phospholipase C-148; Phospholipase C2; phospholipase C-gamma-1; Phospholipase C-II; PLC gamma1; PLC1; Plc-1; PLC148; PLC-148; PLC2I; Plcg1; Plcg-1; PLCgamma1; Plc-gamma1; PLC-gamma-1; PLC-II; PPLCA; triphosphoinositide phosphodiesterase
• Common Name: PLCG1
• Gene Symbol: PLCG1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining