Invitrogen™ Human PLCG2 (aa 425-536) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92496	100 μL

Catalog No. RP92496 Supplier Invitrogen™ Supplier No. RP92496

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82715. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Phosphoinositide-specific phospholipase C (PLC) plays a crucial role in the initiation of receptor mediated signal transduction through the generation of the two second messengers, inositol 1,4,5-triphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. There are many mammalian PLC isozymes, including PLC beta1, PLC beta2, PLC beta3, PLC beta4, PLC gamma1, PLC gamma2, PLC delta1, PLC delta2 and PLCe. PLC delta exists as four different isoforms. PLC delta1, a calcium signal amplifier, is activated by an atypical GTP-binding protein. In addition, PLC delta1 is an effector for GTP-binding protein transglutaminase II-mediated oxytocin receptor and alpha1B-adrenoreceptor signaling. Mouse PLC delta1 is highly expressed in brain, heart, lung and testis. PLC delta is abnormally accumulated in autopsied brains with Alzheimer's disease (AD), suggesting that it may play a role in the pathology of AD. PLC delta2 is markedly expressed in type II intestinal metaplasia and in the adenocarcinoma. When PLC delta2 is expressed in type I intestinal metaplasia, the metaplasia is generally considered benignant, yet evolves toward neoplastic transformation. Thus, PLC delta2 expression may be a possible marker of gastric malignant transformation.

Specifications

• Accession Number: P16885
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5336
• Name: Human PLCG2 (aa 425-536) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; APLAID; FCAS3; phosphoinositide phospholipase C; phosphoinositide phospholipase C-gamma-2; phospholipase C gamma 2; phospholipase C, gamma 2; phospholipase C, gamma 2 (phosphatidylinositol-specific); phospholipase C-gamma-2; Phospholipase C-IV; PLC gamma 2; PLC gamma2; PLC- gamma2; PLC gamma-2; PLCG2; Plcg-2; PLC-gamma; PLCgamma2; PLC-gamma-2; PLC-IV
• Common Name: PLCG2
• Gene Symbol: Plcg2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining