Invitrogen™ Human Pleiotrophin (aa 93-156) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109373	100 μL

Catalog No. RP109373 Supplier Invitrogen™ Supplier No. RP109373

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139921. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pleiotrophin (PTN) is an 18 kDa secreted heparin and chondroitin-binding protein that is a regulatory cytokine critical to the early development of blood vessels and neurons. High PTN serum levels are associated with a variety of solid tumors. It was shown that patients with multiple myeloma (MM) also have elevated serum levels of this protein. The expression of this protein is very limited in normal adult tissues.

Specifications

• Accession Number: P21246
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5764
• Name: Human Pleiotrophin (aa 93-156) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: HARP; HBBM; HBBN; HB-GAM; HBGF8; HBGF-8; HBNF; HBNF1; HBNF-1; heparin affin regulatory peptide; heparin affin regulatory protein; heparin binding factor; heparin-binding brain mitogen; Heparin-binding growth factor 8; heparin-binding growth-associated molecule; heparin-binding neurite outgrowth promoting factor; Heparin-binding neurite outgrowth-promoting factor; Heparin-binding neurite outgrowth-promoting factor 1; heparin-binding neurite promoting factor; heparin-binding neurotorphic factor; heparin-binding neutrophic factor; NEGF1; OSF; Osf1; OSF-1; osteoblastic cell factor; Osteoblast-specific factor 1; pleiotrophin; pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1); Pleiotrophin (Heparine binding factor, Hbnf, in the mouse); PTN
• Common Name: Pleiotrophin
• Gene Symbol: PTN
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining