Invitrogen™ Human PLP1 (aa 85-155) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92332	100 μL

Catalog No. RP92332 Supplier Invitrogen™ Supplier No. RP92332

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLP1 is a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene.This gene encodes a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene.

Specifications

• Accession Number: P60201
• Concentration: 2.1 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5354
• Name: Human PLP1 (aa 85-155) Control Fragment
• pH Range: 7.4
• Purification Method: Metal-chelate chromatography
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: DM20; GPM6C; HLD1; jimpy; jp; lipophilin; lipophilin (aa 129 to 276); major myelin proteolipid protein; MMPL; msd; Myelin proteolipid protein; myelin synthesis deficiency; PLP; PLP/DM20; Plp1; PMD; proteolipid; proteolipid protein; proteolipid protein (myelin) 1; Proteolipid protein (Pelizaeus-Merzbacher disease spastic paraplegia 2 uncomplicated); Proteolipid protein (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated); proteolipid protein 1; proteolipid protein 1 (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated); proteolipid protein, lipophilin; rsh; rump shaker; SPG2
• Common Name: PLP1
• Gene Symbol: PLP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining