Invitrogen™ Human PMP70 (aa 410-474) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102611	100 μL

Catalog No. RP102611 Supplier Invitrogen™ Supplier No. RP102611

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Peroxisomes are single membrane organelles which are involved with many important biochemical pathways and are found in almost all eukaryotic cells. Various toxins including, phenols, alcohols, and aldehydes are targeted for modification by peroxisomes. Long chain fatty acid metabolism via beta-oxidation is also mediated by this organelle. Loss of peroxisomal functions may result in diseases such as Zellweger syndrome, hyperpipecolic acidemia, neonatal adrenoleukodystrophy, and infantile Refsum' disease. Peroxisomal membrane protein 70 (PMP70) is an abundant, integral membrane protein of the peroxisome. This protein is induced by treatment with hypolipidemic agents in parallel with peroxisome proliferation and stimulation of the peroxisomal beta-oxidation enzymes.

Specifications

• Accession Number: P28288
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5825
• Name: Human PMP70 (aa 410-474) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 68 kDa peroxisomal membrane protein; 70 kDa peroxisomal membrane protein; 70-kDa peroxisomal membrane protein; ABC43; ABCD3; AI313901; ATP binding cassette subfamily D member 3; ATP-binding cassette sub-family D member 3; ATP-binding cassette, subfamily D (ALD), member 3; ATP-binding cassette, sub-family D (ALD), member 3; AU018866; AW146054; CBAS5; dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1)); Peroxisomal membrane protein 1; peroxisomal membrane protein 1 (70kD, Zellweger syndrome); peroxisomal membrane protein, 70 kDa; Peroxisomal membrane protein-1 (70kD); PMP68; Pmp70; Pxmp1; ZWS2
• Common Name: PMP70
• Gene Symbol: ABCD3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining