Invitrogen™ Human POC5 (aa 470-569) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107074	100 μL

Catalog No. RP107074 Supplier Invitrogen™ Supplier No. RP107074

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84503. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Essential for the assembly of the distal half of centrioles, required for centriole elongation.

Specifications

• Accession Number: Q8NA72
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 134359
• Name: Human POC5 (aa 470-569) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1200014M14Rik; AV144706; C5orf37; Centrosomal protein POC5; hPOC5; Poc5; POC5 centriolar protein; POC5 centriolar protein homolog; POC5 centriolar protein homolog (Chlamydomonas); protein of centriole 5; proteome of centriole 5; RGD1310597
• Common Name: POC5
• Gene Symbol: POC5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YVPRVVTSAQQKAGRTITARITGRCDFASKNRISSSLAIMGVSPPMSSVVVEKHHPVTVQTIPQATAAKYPRTIHPESSTSASRSLGTRSAHTQSLTSVH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining