Invitrogen™ Human POLA1 (aa 263-381) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92178	100 μL

Catalog No. RP92178 Supplier Invitrogen™ Supplier No. RP92178

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51784. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA replication, recombination and repair, all of which are necessary for genomic stability, require the presence of exonucleases. In DNA replication, these enzymes are involved in the processing of Okazaki fragments, whereas in DNA repair they function to excise damaged DNA fragments and correct recombinational mismatches. These exonucleases include the family of DNA polymerases. DNA pol alpha, beta, delta and epsilon are involved in DNA replication and repair. DNA pol delta and DNA pol epsilon are multisubunit enzymes, with DNA pol delta consisting of two subunits: p125, which interacts with the sliding DNA clamp protein PCNA; and p50. The nuclear-encoded DNA pol gamma is the only DNA polymerase required for the replication of the mitochondrial DNA. DNA pol zeta is ubiquitously expressed in various tissues and mediates the cellular mechanism of damage-induced mutagenesis. DNA pol theta is a DNA polymerase-helicase that binds ATP and is involved in the repair of interstrand crosslinks.

Specifications

• Accession Number: P09884
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5422
• Name: Human POLA1 (aa 263-381) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AW321876; DNA pol alpha; DNA polymerase alpha 1 catalytic subunit; DNA polymerase alpha 1, 180 kDa; DNA polymerase alpha 1, catalytic subunit; DNA polymerase alpha catalytic subunit; DNA polymerase alpha catalytic subunit p180; DNA polymerase alpha p180 subunit; DNA polymerase alpha subunit I; G7a/Bat6Hom; NSX; p180; Pola; Pola1; polymerase (DNA directed), alpha 1; polymerase (DNA directed), alpha 1, catalytic subunit; polymerase (DNA) alpha 1, catalytic subunit; polymerase (DNA-directed), alpha (70kD); polymerase, alpha 1
• Common Name: POLA1
• Gene Symbol: POLA1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining