Invitrogen™ Human POLE3 (aa 1-65) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100962	100 μL

Catalog No. RP100962 Supplier Invitrogen™ Supplier No. RP100962

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83889. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: Q9NRF9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54107
• Name: Human POLE3 (aa 1-65) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1810034K18Rik; arsenic transactivated protein; arsenic-transactivated protein; AsTP; CHARAC17; CHRAC 17; CHRAC17; CHRAC-17; Chromatin accessibility complex 17 kDa protein; DNA polymerase epsilon 3, accessory subunit; DNA polymerase epsilon p17 subunit; DNA polymerase epsilon subunit 3; DNA polymerase epsilon subunit p17; DNA polymerase epsilon, subunit 3; DNA polymerase II subunit 3; DNA-directed DNA polymerase epsilon 3; histone fold protein CHRAC17; huCHRAC17; NF-YB-like protein; p17; Pole3; polymerase (DNA directed), epsilon 3 (p17 subunit); polymerase (DNA directed), epsilon 3, accessory subunit; polymerase (DNA) epsilon 3, accessory subunit; YBL1; YB-like protein 1
• Common Name: POLE3
• Gene Symbol: POLE3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining