Invitrogen™ Human POLH (aa 110-258) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89495	100 μL

Catalog No. RP89495 Supplier Invitrogen™ Supplier No. RP89495

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55409. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The XPA gene encodes a zinc metalloprotein that preferentially binds to DNA damaged by UV radiation and chemical carcinogens and is required for the incision step during nucleotide excision repair The XPB and XPD genes encode DNA helicases involved in several DNA metabolic pathways, including DNA repair and transcription, and the XPG gene product is an endonuclease that cuts on the 3' side of a DNA lesion during nucleotide excision repair. Molecular defects in the XP variant (POL H) group maintain normal excision repair, yet they result in a substantial reduction in the ability to synthesize intact daughter DNA strands during DNA replication following DNA damage.

Specifications

• Accession Number: Q9Y253
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5429
• Name: Human POLH (aa 110-258) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: DNA polymerase eta; DNA-directed DNA polymerase eta; FLJ16395; FLJ21978; Polh; polymerase (DNA directed), eta; polymerase (DNA directed), eta (RAD 30 related); polymerase (DNA) eta; RAD30; RAD30 homolog A; RAD30A; Xeroderma pigmentosum variant type protein; xeroderma pigmentosum variant type protein homolog; XP V; XPV; XP-V
• Common Name: POLH
• Gene Symbol: POLH
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining