Invitrogen™ Human POLR2E (aa 55-133) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104001	100 μL

Catalog No. RP104001 Supplier Invitrogen™ Supplier No. RP104001

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64389. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the fifth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases and is present in two-fold molar excess over the other polymerase subunits. An interaction between this subunit and a hepatitis virus transactivating protein has been demonstrated, suggesting that interaction between transcriptional activators and the polymerase can occur through this subunit. A pseudogene is located on chromosome 11.

Specifications

• Accession Number: P19388
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5434
• Name: Human POLR2E (aa 55-133) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2410021N14Rik; 25kDa; AW208866; DNA directed RNA polymerase II 23 kda polypeptide; DNA-directed RNA polymerase II 23 kDa polypeptide; DNA-directed RNA polymerase II subunit E; DNA-directed RNA polymerase subunit RPABC1; DNA-directed RNA polymerases I, II, and III subunit RPABC1; hRPB25; hsRPB5; Polr2e; polymerase (RNA) II (DNA directed) polypeptide E; polymerase (RNA) II (DNA directed) polypeptide E, 25kDa; polymerase (RNA) II subunit E; RNA polymerase II subunit E; RNA polymerase II, I and III subunit E; RNA polymerases I, II, and III subunit ABC1; RPABC1; RPB5; RPB5 homolog; XAP4
• Common Name: POLR2E
• Gene Symbol: POLR2E
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining