Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human POLR2H (aa 77-150) Control Fragment Recombinant Protein

Catalog No. RP105027
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105027 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105027 Supplier Invitrogen™ Supplier No. RP105027
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eukaryotes produce 3 distinct classes of RNA polymerase, Pol I, II and III. Each polymerase is responsible for the synthesis of a different class of RNA. RNA polymerase I (Pol I) transcribes the rRNA (ribosomal RNA) genes for the precursor of the 28S, 18S, and 5. 8S molecules of the ribosome. RNA polymerase II transcribes protein-encoding genes into mRNA (messenger RNA) and snRNA (small nuclear RNA) genes into snRNAs that influence the processing of other classes of RNA. RNA polymerase III (Pol III) transcribes the 5S rRNA genes and all of the tRNA (transfer RNA) genes. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. The RPB6 and RPB8 subunits are shared by all 3 RNA polymerases.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P52434
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 5437
Name Human POLR2H (aa 77-150) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias ABC3; DNA-directed RNA polymerase II subunit H; DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide; DNA-directed RNA polymerases I, II, and III subunit RPABC3; hRPB8; hsRPB8; POLR2H; polymerase (RNA) II (DNA directed) polypeptide H; polymerase (RNA) II subunit H; RGD1561203; RNA polymerase II subunit H; RNA polymerases I, II, and III subunit ABC3; RPABC3; RPB17; RPB8; RPB8 homolog
Common Name POLR2H
Gene Symbol POLR2H
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.