Invitrogen™ Human POLR3K (aa 6-108) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89380	100 μL

Catalog No. RP89380 Supplier Invitrogen™ Supplier No. RP89380

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52220. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eukaryotes produce 3 distinct classes of RNA polymerase, Pol I, II and III. Each polymerase is responsible for the synthesis of a different class of RNA. RNA polymerase III (Pol III) transcribes the 5S rRNA genes and all of the tRNA (transfer RNA) genes. POLR3K, also known as DNA-directed RNA polymerase III subunit RPC11, is a 108 amino acid nuclear protein that is one of the seventeen subunits that comprise Pol III. Specifically, POLR3K is a DNA-dependent RNA polymerase that uses the four ribonucleoside triphosphates to catalyze the transcription of DNA to RNA. The gene encoding POLR3K maps to human chromosome 16, which encodes over 900 genes in approximately 90 million base pairs and is associated with a variety of genetic disorders.

Specifications

• Accession Number: Q9Y2Y1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 51728
• Name: Human POLR3K (aa 6-108) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 12.3kDa; 1500004O14Rik; AI196849; AU014893; C11; C11-RNP3; DNA-directed RNA polymerase III subunit K; DNA-directed RNA polymerase III subunit RPC10; DNA-directed RNA polymerases III 12.5 kDa polypeptide; estrous-specific protein, 250 kDa; hRPC11; HsC11p; My010; POLR3K; polymerase (RNA) III (DNA directed) polypeptide K; polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa; polymerase (RNA) III subunit K; RNA polymerase III 12.5 kDa subunit; RNA polymerase III subunit C10; RNA polymerase III subunit C11; RNA polymerase III subunit CII; RNA polymerase III subunit K; RPC10; RPC11; RPC12.5
• Common Name: POLR3K
• Gene Symbol: POLR3K
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining