Invitrogen™ Human POT1 (aa 104-188) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105452	100 μL

Catalog No. RP105452 Supplier Invitrogen™ Supplier No. RP105452

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66996. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

POT1 is a component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. It is a component of the double-stranded telomeric DNA-binding TRF1 complex which is involved in the regulation of telomere length by cis-inhibition of telomerase. Pot1 also acts as a single-stranded telomeric DNA-binding protein and thus may act as a downstream effector of the TRF1 complex and may transduce information about telomere maintenance and/or length to the telomere terminus. It binds to two or more telomeric single-stranded 5'-TTAGGG-3' repeats (G-strand) and with high specificity to a minimal telomeric single-stranded 5'-TAGGGTTAG-3' sequence. Its activity is TERT dependent but it does not increase TERT activity.

Specifications

• Accession Number: Q9NUX5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 25913
• Name: Human POT1 (aa 104-188) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1500031H18Rik; AI505244; AI851169; CMM10; DKFZp586D211; Dolichyl-phosphate-mannose--protein mannosyltransferase 1; GLM9; HPOT1; mPot1; Pomt1; POT 1; POT1; POT-1; Pot1a; POT1-like telomere end-binding protein; protection of telomeres 1; protection of telomeres 1 homolog; protection of telomeres 1A; protection of telomeres protein 1; protein O-mannosyltransferase 1; Protein O-mannosyl-transferase 1; protein-O-mannosyltransferase 1
• Common Name: POT1
• Gene Symbol: POT1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining