Invitrogen™ Human POU5F1B (aa 51-101) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105098	100 μL

Catalog No. RP105098 Supplier Invitrogen™ Supplier No. RP105098

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66155. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This intronless gene was thought to be a transcribed pseudogene of POU class 5 homeobox 1, however, it has been reported that this gene can encode a functional protein. The encoded protein is nearly the same length as and highly similar to the POU class 5 homeobox 1 transcription factor, has been shown to be a weak transcriptional activator and may play a role in carcinogenesis and eye development.

Specifications

• Accession Number: Q06416
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5462
• Name: Human POU5F1B (aa 51-101) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: OCT4PG1; Oct4-pg1; octamer binding protein 3_like sequence; Octamer-binding protein 3-like; Octamer-binding transcription factor 3-like; OTF3C; OTF3P1; POU 5 domain protein; POU class 5 homeobox 1 pseudogene 1; POU class 5 homeobox 1B; POU domain transcription factor Oct-4; POU domain transcription factor OCT4-pg1; POU domain, class 5, transcription factor 1 pseudogene 1; POU5F1B; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8; Putative POU domain, class 5, transcription factor 1B
• Common Name: POU5F1B
• Gene Symbol: POU5F1B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining