Invitrogen™ Human PPAR alpha (aa 173-217) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106902	100 μL

Catalog No. RP106902 Supplier Invitrogen™ Supplier No. RP106902

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Peroxisome proliferators are non-genotoxic carcinogens which are purported to exert their effect on cells through their interaction with members of the nuclear hormone receptor family termed peroxisome proliferator activated receptors (PPAR's). Nuclear hormone receptors are ligand-dependent intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate ligand. Studies indicate that PPAR's are activated by peroxisome proliferators such as clofibric acid, nafenopin, and WY-14,643, as well as by some fatty acids. It has also been shown that PPAR's can induce transcription of acyl coenzyme A oxidase & cytochrome P450 (CYP450) A6 through interaction with specific response elements. PPAR, like several other nuclear hormone receptors, heterodimerizes with retinoid X receptor (RXR) alpha.

Specifications

• Accession Number: Q07869
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5465
• Name: Human PPAR alpha (aa 173-217) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4933429D07Rik; AW742785; hPPAR; I79_022392; MGC2237; MGC2452; Nr1c1; nuclear hormone receptor; nuclear receptor; nuclear receptor subfamily 1 group C member 1; peroxisome proliferative activated receptor alpha; peroxisome proliferative activated receptor, alpha; peroxisome proliferative activated receptor, alpha isoform 1; peroxisome proliferator; peroxisome proliferator activated receptor; peroxisome proliferator activated receptor alpha; peroxisome proliferator-activated nuclear receptor alpha variant 3; peroxisome proliferator-activated receptor alpha; PPAR; PPAR ALPHA; Ppara; PPARALPHA; PPAR-alpha; proliferator-activated receptor alpha; transcription factor belonging to the nuclear receptor superfamily
• Common Name: PPAR alpha
• Gene Symbol: PPARA
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining