Invitrogen™ Human PPBP (aa 39-128) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89527	100 μL

Catalog No. RP89527 Supplier Invitrogen™ Supplier No. RP89527

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52549. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the a-chemokine subfamily of inducible, secreted, pro-inflammatory cytokines contain a similar motif, in which the first two cysteine residues are separated by a single residue (Cys-X-Cys), and are also chemotactic for neutrophils. The platelet basic protein (PBP), a member of the a-chemokine family, resides in the a-granules of platelets and is released upon their activation. Proteolytic cleavage of the amino terminus of PBP leads to the generation of several peptides, which include mature PBP, connective tissue-activating peptide III (CTAP III, also designated low affinity platelet factor IV (LA-PF4)), b-thromboglobulin (b-TG), and neutrophil-activating peptide 2 (NAP-2). PBP and its N-truncated derivatives mediate inflammation and wound healing. Specifically, NAP-2 activates chemotaxis and degranulation in neutrophils during inflammation. The gene encoding human PBP maps to chromosome 4q12-q13.

Specifications

• Accession Number: P02775
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5473
• Name: Human PPBP (aa 39-128) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2400003M24Rik; AI854500; Beta-TG; Beta-thromboglobulin; b-TG1; chemokine (C-X-C motif) ligand 7; connective tissue-activating peptide III; Connective tissue-activating peptide III(1-81); CTAP3; CTAPIII; CTAP-III; CTAP-III(1-81); CXC chemokine ligand 7; C-X-C motif chemokine 7; CXCL7; LA-PF4; LDGF; Leukocyte-derived growth factor; low-affinity platelet factor IV; Macrophage-derived growth factor; MDGF; NAP-2; NAP-2(1-63); NAP-2(1-66); NAP-2(73); NAP-2(74); NAP-2-L1; neutrophil activating peptide-2; neutrophil-activating peptide 2; Neutrophil-activating peptide 2(1-63); Neutrophil-activating peptide 2(1-66); Neutrophil-activating peptide 2(73); Neutrophil-activating peptide 2(74); neutrophil-activating peptide-2; PBP; Platelet basic protein; PPBP; pro-platelet basic protein; pro-platelet basic protein (chemokine (C-X-C motif) ligand 7); SCYB7; small inducible cytokine B7; small inducible cytokine subfamily B, member 7; small-inducible cytokine B7; TC1; TC-1; TC2; TC-2; TGB; TGB1; THBGB; THBGB1; thrombocidin 1; thrombocidin 2; thromboglobulin, beta-1
• Common Name: PPBP
• Gene Symbol: PPBP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining