Invitrogen™ Human PPFIA3 (aa 671-741) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99162	100 μL

Catalog No. RP99162 Supplier Invitrogen™ Supplier No. RP99162

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60420. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The PPFIA3 protein is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family, a family of transmembrane protein tyrosine phosphatases known to be important for axon guidance and mammary gland development. Similar to the other liprin family members, PPFIA3 can interact with ERC2, a member of the ELKS-Rab6-interacting protein-CAST family of proteins at the presynaptic termini, suggesting that these proteins may play a role in the molecular organization of presynaptic zones.

Specifications

• Accession Number: O75145
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8541
• Name: Human PPFIA3 (aa 671-741) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2410127E16Rik; KIAA0654; liprin; liprin-alpha 3; Liprin-alpha3; liprin-alpha-3; liprin-alpha-3; LOW QUALITY PROTEIN: liprin-alpha-3; LPNA3; PPFIA3; Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-3; protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3; protein tyrosine phosphatase, receptor type, f polypeptide, alpha 3; PTPRF interacting protein alpha 3; PTPRF-interacting protein alpha-3
• Common Name: PPFIA3
• Gene Symbol: PPFIA3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSGHSTPRLAPPSPAREGTDKANHVPKEEAGAPRGEGPAIPGDTPPPTPRSARLERMTQALALQAGSLEDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining