Invitrogen™ Human PPFIBP2 (aa 430-530) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102101	100 μL

Catalog No. RP102101 Supplier Invitrogen™ Supplier No. RP102101

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51666. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The PPFIBP2 (PPFIA Binding Protein 2) gene encodes a protein that belongs to the liprin family, which is involved in intracellular signaling and cytoskeletal organization. Located on chromosome 1, PPFIBP2 is primarily known for its role in synaptic function and cell adhesion. The protein interacts with receptor protein tyrosine phosphatases, particularly PTPRF and PTPRD, and plays a critical role in the formation and maintenance of synaptic contacts. PPFIBP2 facilitates the proper localization of synaptic vesicles and synapse-specific proteins, contributing to synaptic stability and plasticity. Disruption of PPFIBP2 expression or function has been linked to neurological disorders, emphasizing its importance in neural communication. Additionally, PPFIBP2 has been implicated in cancer, where it may influence tumor cell adhesion and migration.

Specifications

• Accession Number: Q8ND30
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8495
• Name: Human PPFIBP2 (aa 430-530) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Cclp1; coiled-coil-like protein 1; liprin beta 2; liprin-beta-2; PPFIA binding protein 2; Ppfibp2; Protein tyrosine phosphatase receptor type f polypeptide-interacting protein-binding protein 2; protein tyrosine phosphatase, receptor-type, F interacting protein, binding protein 2; PTPRF interacting protein, binding protein 2 (liprin beta 2); PTPRF-interacting protein-binding protein 2
• Common Name: PPFIBP2
• Gene Symbol: PPFIBP2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SGATPNGEAAKSPPTICQPDATGSSLLRLRDTESGWDDTAVVNDLSSTSSGTESGPQSPLTPDGKRNPKGIKKFWGKIRRTQSGNFYTDTLGMAEFRRGGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining