Invitrogen™ Human PPIL6 (aa 234-298) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108953	100 μL

Catalog No. RP108953 Supplier Invitrogen™ Supplier No. RP108953

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140089. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

Specifications

• Accession Number: Q8IXY8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 285755
• Name: Human PPIL6 (aa 234-298) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2900084F20Rik; bA425D10.6; Cyclophilin-like protein PPIL6; dJ919F19.1; peptidyl-prolyl cis-trans isomerase-like 6; peptidyl-prolyl cis-trans isomerase-like variant a; peptidylprolyl isomerase (cyclophilin)-like 6; peptidylprolyl isomerase like 6; PPIase; PPIL6; Probable inactive peptidyl-prolyl cis-trans isomerase-like 6; radial spoke 12 homolog; rotamase PPIL6; RSPH12
• Common Name: PPIL6
• Gene Symbol: PPIL6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SVPHNKRGVLGMANKGRHSNGSQFYITLQATPYLDRKFVAFGQLIEGTEVLKQLELVPTQNERPI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining