Invitrogen™ Human PPM1B (aa 359-463) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91561	100 μL

Catalog No. RP91561 Supplier Invitrogen™ Supplier No. RP91561

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82557. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent kinases (CDKs), and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to cause cell-growth arrest or cell death. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional transcript variants have been described, but currently do not represent full-length sequences.

Specifications

• Accession Number: O75688
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5495
• Name: Human PPM1B (aa 359-463) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: EGK_05287; Pp2c2; PP2CB; PP2CBETA; PP2C-beta; PP2C-beta-X; PPC2BETAX; PPM1B; Pppm1b; Protein phosphatase 1B; protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform; protein phosphatase 1B, magnesium dependent, beta isoform; protein phosphatase 2C isoform beta; protein phosphatase 2C-like protein; Protein phosphatase type 1B (formely 2C) Mg-dependent beta isoform; Protein phosphatase type 1B (formely 2C), Mg-dependent, beta isoform; protein phosphatase, Mg2+/Mn2+ dependent 1B; protein phosphatase, Mg2+/Mn2+ dependent, 1B; Ser/Thr protein phosphatase type 2C beta 2 isoform
• Common Name: PPM1B
• Gene Symbol: PPM1B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining