Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human PPM1E (aa 195-233) Control Fragment Recombinant Protein

Catalog No. RP107156
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107156 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107156 Supplier Invitrogen™ Supplier No. RP107156
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66481. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein phosphatase that inactivates multifunctional CaM kinases such as CAMK4 and CAMK2. Dephosphorylates and inactivates PAK. May play a role in the inhibition of actin fiber stress breakdown and in morphological changes driven by TNK2/CDC42. Dephosphorylates PRKAA2.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WY54, Q96MI6
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 132160, 22843
Name Human PPM1E (aa 195-233) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AW049266; B930008A12Rik; Ca(2+)/calmodulin-dependent protein kinase phosphatase N; calmodulin-dependent protein kinase phosphatase N; caMKN; CaMKP-N; caMKP-nucleus; Kiaa1072; mKIAA1072; nuclear calmodulin-dependent protein kinase phosphatase; partner of PIX 1; partner of PIXA; Partner of PIX-alpha; POPX1; PP2CE; PP2Ceta; PP2C-eta; PP2CH; PPM1E; PPM1M; Protein phosphatase 1E; protein phosphatase 1E (PP2C domain containing); protein phosphatase 1M; protein phosphatase 1M (PP2C domain containing); protein phosphatase 2C eta-2; protein phosphatase 2C isoform eta; protein phosphatase, Mg2+/Mn2+ dependent 1E; protein phosphatase, Mg2+/Mn2+ dependent 1M; protein phosphatase, Mg2+/Mn2+ dependent, 1E; protein phosphatase, Mg2+/Mn2+ dependent, 1M
Common Name PPM1E
Gene Symbol PPM1E, PPM1M
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AFQECDEVIGRELEASGQMGGCTALVAVSLQGKLYMANA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.