Invitrogen™ Human PPM1G (aa 466-538) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96008	100 μL

Catalog No. RP96008 Supplier Invitrogen™ Supplier No. RP96008

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57308. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described.

Specifications

• Accession Number: O15355
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5496
• Name: Human PPM1G (aa 466-538) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI385652; fibroblast growth factor inducible 13; fibroblast growth factor-inducible protein 13; Fin13; PP2C, gamma; PP2CG; PP2CGAMMA; PP2C-gamma; Ppm1c; Ppm1g; PPP2CG; protein phosphatase 1C; Protein phosphatase 1G; protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform; protein phosphatase 2, catalytic subunit, gamma isoform; protein phosphatase 2C gamma isoform; protein phosphatase 2C isoform gamma; Protein phosphatase magnesium-dependent 1 gamma; protein phosphatase, Mg2+/Mn2+ dependent 1G; protein phosphatase, Mg2+/Mn2+ dependent, 1G
• Common Name: PPM1G
• Gene Symbol: Ppm1g
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining