Invitrogen™ Human PPP2R3A (aa 205-286) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107424	100 μL

Catalog No. RP107424 Supplier Invitrogen™ Supplier No. RP107424

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B'/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holoenzyme. The product of this gene belongs to the B' family. The B' family has been further divided into subfamilies. The product of this gene belongs to the alpha subfamily of regulatory subunit B'. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: Q06190
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5523
• Name: Human PPP2R3A (aa 205-286) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 3222402P14Rik; A730042E07; DNA for thyroid hormone receptor binding site (258bp); PP2A subunit B isoform PR72/PR130; PP2A subunit B isoform R3 isoform; PP2A subunit B isoforms B72/B130; PP2A subunit B isoforms B''-PR72/PR130; PP2A, subunit B, R3 isoform; PPP2R3; PPP2R3A; PR130; PR72; protein phosphatase 2 (formerly 2A), regulatory subunit B'' (PR 72), alpha isoform and (PR 130), beta isoform; protein phosphatase 2 (formerly 2A), regulatory subunit B'', alpha; protein phosphatase 2 regulatory subunit B'', alpha; protein phosphatase 2 regulatory subunit B''alpha; protein phosphatase 2, regulatory subunit B'', alpha; serine/threonine-protein phosphatase 2A 72/130 kDa regulatory subunit B; Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha; Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha-like protein
• Common Name: PPP2R3A
• Gene Symbol: PPP2R3A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining