Invitrogen™ Human PPP2R3C (aa 11-123) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106895	100 μL

Catalog No. RP106895 Supplier Invitrogen™ Supplier No. RP106895

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66214. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

P2R3C may regulate MCM3AP phosphorylation through phosphatase recruitment. It may play a role in the activation-induced cell death of B-cells.

Specifications

• Accession Number: Q969Q6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 55012
• Name: Human PPP2R3C (aa 11-123) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4930511A21Rik; 5730412A08Rik; C14orf10; chromosome 14 open reading frame 10; G4-1; G5pr; hypothetical protein LOC533147; MNCb-1932; phosphatase subunit gene g4-1; Ppp2r3c; protein phosphatase 2 (formerly 2A), regulatory subunit B''; protein phosphatase 2 (formerly 2A), regulatory subunit B'', gamma; protein phosphatase 2 regulatory subunit B'', gamma; protein phosphatase 2 regulatory subunit B''gamma; protein phosphatase 2, regulatory subunit B'', gamma; protein phosphatase subunit G5PR; RGD1309207; rhabdomyosarcoma antigen MU-RMS-40.6A; Rhabdomyosarcoma antigen MU-RMS-40.6A/6C; rhabdomyosarcoma antigen Mu-RMS-40.6C; serine/threonine-protein phosphatase 2A regulatory subunit B'' gamma subunit; serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma; similar to phosphatase subunit gene g4-1; zgc:55473
• Common Name: PPP2R3C
• Gene Symbol: Ppp2r3c
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining