Invitrogen™ Human PPP2R5C (aa 375-474) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP88937	100 μL

Catalog No. RP88937 Supplier Invitrogen™ Supplier No. RP88937

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82984. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Phosphatases are involved in the regulation of MAP kinases.Protein phosphatase 2A (PP2A) is a critical component of the pathway responsible for p38 MAPK up-regulation of SERT catalytic activity.

Specifications

• Accession Number: Q13362
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5527
• Name: Human PPP2R5C (aa 375-474) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2610043M05Rik; 2700063L20Rik; AI060890; AW545884; B' alpha regulatory subunit; B55-GAMMA; B56/PP2A gamma; B56G; Band 8A; C85228; D12Bwg0916e; gamma isoform of regulatory subunit B56, protein phosphatase 2A; IMYPNO; IMYPNO1; KIAA0044; MGC23064; MGC33570; mKIAA0044; PP2A B subunit isoform B56-gamma; PP2A B subunit isoform B'-alpha-3; PP2A B subunit isoform B'-gamma; PP2A B subunit isoform PR61-gamma; PP2A B subunit isoform R5-gamma; Ppp2r5c; PR52; PR55G; PR61G; protein phosphatase 2 regulatory subunit B', gamma; protein phosphatase 2 regulatory subunit B'gamma; protein phosphatase 2, regulatory subunit B (B56), gamma isoform; protein phosphatase 2, regulatory subunit B', gamma; protein phosphatase 2, regulatory subunit B', gamma isoform; renal carcinoma antigen NY-REN-29; Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
• Common Name: PPP2R5C
• Gene Symbol: PPP2R5C
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQAQKDPKKDRPLARRKSELPQDPHTKKALEAHC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining