Abnova™ Human PPT2 Partial ORF (NP_005146, 203 a.a. - 302 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Manufacturer:  Abnova™ H00009374Q01L

Catalog No. 89-957-982

Description

This gene encodes a member of the palmitoyl-protein thioesterase family. The encoded glycosylated lysosomal protein has palmitoyl-CoA hydrolase activity in vitro, but does not hydrolyze palmitate from cysteine residues in proteins. Three transcript variants encoding different isoforms have been described for this gene, with one of the isoforms being inactive. [provided by RefSeq]

Sequence: DHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPWLS

Specifications

• Expression System: wheat germ expression system
• For Use With (Application): Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight: 36.74kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: DHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPWLS
• Regulatory Status: RUO
• Common Name: PPT2
• Host Species: Wheat Germ (in vitro)
• Protein Tag: GST

• Accession Number: NP_005146
• Format: Liquid
• Gene ID (Entrez): 9374
• Name: PPT2 (Human) Recombinant Protein (Q01)
• Quantity: 25 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: C6orf8/DKFZp564P1516/G14
• Gene Symbol: PPT2
• Recombinant: Yes