Invitrogen™ Human PRDM10 (aa 863-950) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109009	100 μL

Catalog No. RP109009 Supplier Invitrogen™ Supplier No. RP109009

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140103. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GPIP137 may regulate the transport and translation of mRNAs of proteins involved in synaptic plasticity in neurons and cell proliferation and migration in multiple cell types. It is expressed in the cytoplasm.

Specifications

• Accession Number: Q9NQV6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 56980
• Name: Human PRDM10 (aa 863-950) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Gm1112; KIAA1231; MGC131802; PFM7; PR domain 10; PR domain containing 10; PR domain zinc finger protein 10; PR domain-containing protein 10; PRDM zinc finger transcription factor; PRDM10; PR-domain family member 7; RGD1560384; TRIS; tristanin
• Common Name: PRDM10
• Gene Symbol: PRDM10
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining