Abnova™ Human PRG4 Partial ORF (NP_005798, 1305 a.a. - 1404 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-958-085	25 μg
89-958-084	10 μg

Catalog No. 89-958-085 Supplier Abnova™ Supplier No. H00010216Q01L

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a large proteoglycan specifically synthesized by chondrocytes located at the surface of articular cartilage, and also by some synovial lining cells. This protein contains both chondroitin sulfate and keratan sulfate glycosaminoglycans. It functions as a boundary lubricant at the cartilage surface and contributes to the elastic absorption and energy dissipation of synovial fluid. Mutations in this gene result in camptodactyly-arthropathy-coxa vara-pericarditis syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP

Specifications

• Accession Number: NP_005798
• For Use With (Application): Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 10216
• Molecular Weight (g/mol): 36.74kDa
• Name: Human PRG4 Partial ORF (NP_005798, 1305 a.a. - 1404 a.a.) Recombinant Protein with GST-tag at N-terminal
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Storage Requirements: Store at −80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CACP, FLJ32635, HAPO, JCAP, MSF, SZP, bG174L6.2
• Common Name: PRG4
• Gene Symbol: PRG4
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST Tag
• Expression System: wheat germ expression system
• Form: Liquid