Abnova™ Human PRG4 Partial ORF (NP_005798, 1305 a.a. - 1404 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Catalog Number	Mfr. No.	Quantity
89-958-085	Abnova™ H00010216Q01L	25μg
89-958-084	Abnova™ H00010216Q01S	10μg

Description

The protein encoded by this gene is a large proteoglycan specifically synthesized by chondrocytes located at the surface of articular cartilage, and also by some synovial lining cells. This protein contains both chondroitin sulfate and keratan sulfate glycosaminoglycans. It functions as a boundary lubricant at the cartilage surface and contributes to the elastic absorption and energy dissipation of synovial fluid. Mutations in this gene result in camptodactyly-arthropathy-coxa vara-pericarditis syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP

Specifications

• Name: Human PRG4 Partial ORF (NP_005798, 1305 a.a. - 1404 a.a.) Recombinant Protein with GST-tag at N-terminal
• For Use With (Application): AP, Array, ELISA, WB-Re
• Storage Requirements: Store at −80°C. Aliquot to avoid repeated freezing and thawing.

• Recombinant: Yes
• Molecular Weight: 36.74kDa