Invitrogen™ Human PRKAR2B (aa 15-135) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101914	100 μL

Catalog No. RP101914 Supplier Invitrogen™ Supplier No. RP101914

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. This subunit has been shown to interact with and suppress the transcriptional activity of the cAMP responsive element binding protein 1 (CREB1) in activated T cells. Knockout studies in mice suggest that this subunit may play an important role in regulating energy balance and adiposity. The studies also suggest that this subunit may mediate the gene induction and cataleptic behavior induced by haloperidol.

Specifications

• Accession Number: P31323
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5577
• Name: Human PRKAR2B (aa 15-135) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI451071; AW061005; cAMP-dependent protein kinase RII-beta regulatory subunit; cAMP-dependent protein kinase type II-beta regulatory chain; cAMP-dependent protein kinase type II-beta regulatory subunit; H_RG363E19.2; Pkarb2; PKARIIbeta; PRKAR2; PRKAR2B; protein kinase cAMP-dependent type II regulatory subunit beta; protein kinase, cAMP dependent regulatory, type II beta; protein kinase, cAMP-dependent, regulatory subunit type II beta; protein kinase, cAMP-dependent, regulatory, type II, beta; RATDNA; RII(beta); RII-BETA; Type II beta regulatory subunit of cAMP-dependent protein kinase; WUGSC:H_RG363E19.2
• Common Name: PRKAR2B
• Gene Symbol: Prkar2b
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining