Invitrogen™ Human PrP (aa 143-219) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99454	100 μL

Catalog No. RP99454 Supplier Invitrogen™ Supplier No. RP99454

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111160. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Human prion protein (PrP), also known as PRNP, is a ubiquitously expressed GPI-anchored cell surface glycoprotein associating with lipid raft components and functioning as a signaling molecule. PrP plays a role in apoptosis in a cell context-dependent manner, is involved in proliferation of epithelial cells and in distribution of junction-associated proteins in human enterocytes. Conversion of this normal cellular prion protein (PrPc) into an abnormal conformer (PrPSc) is the crucial step associated with triggering the pathogenesis of the prion neurodegenerative disorders, such as the Creutzfeld-Jakob disease (CJD). Whereas PrPc is rich in alpha-helices, the PrPSc form has higher content of beta-sheets and is resistant to proteinase K.

Specifications

• Accession Number: F7VJQ1, P04156
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5621
• Name: Human PrP (aa 143-219) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AA960666; AI325101; Alternative prion protein; alternative prion protein; major prion protein; AltPrP; ASCR; BSE; CD230; CD230 antigen; CJD; GSS; KURU; major prion protein; major prion protein; alternative prion protein; major scrapie-associated fibril protein 1; MGC26679; p27-30; PK resistant core; prion protein; prion protein (p27-30) (Creutzfeldt-Jakob disease, Gerstmann-Strausler-Scheinker syndrome, fatal familial insomnia); prion protein precursor; prion protein precursor PrP; prion protein PrP; prion protein variant a; prion protein variant b; prion protein, PrP; prion protein, structural; prion-related protein; PRIP; Prn; Prn-i; Prnp; Prn-p; PrP; PrP>C>; PrP27-30; PrP33-35C; PrPc; PrPSc; Sinc; SIP; TSE
• Common Name: PrP
• Gene Symbol: PRNP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining