Invitrogen™ Human PRP6 (aa 246-331) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99302	100 μL

Catalog No. RP99302 Supplier Invitrogen™ Supplier No. RP99302

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61428. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. The encoded protein also can bind androgen receptor, providing a link between transcriptional activation and splicing.

Specifications

• Accession Number: O94906
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 24148
• Name: Human PRP6 (aa 246-331) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1190003A07Rik; 2610031L17Rik; androgen receptor N-terminal domain transactivating protein-1; androgen receptor N-terminal domain-transactivating protein 1; ANT1; ANT-1; C20orf14; hPrp6; p102 U5 small nuclear ribonucleoprotein particle-binding protein; pre-mRNA processing factor 6; pre-mRNA-processing factor 6; Prp6; PRP6 homolog; PRP6 pre-mRNA processing factor 6 homolog; PRP6 pre-mRNA splicing factor 6 homolog; PRP6 pre-mRNA splicing factor 6 homolog (yeast); Prpf6; putative mitochondrial outer membrane protein import receptor; RGD1307103; RP60; SNRNP102; TOM; U5 snRNP-associated 102 kDa protein; U5-102 kDa protein; U5-102K
• Common Name: PRP6
• Gene Symbol: PRPF6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining