Invitrogen™ Human PRPF18 (aa 62-144) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP97130	100 μL

Catalog No. RP97130 Supplier Invitrogen™ Supplier No. RP97130

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58031. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRPF18 (pre-mRNA-splicing factor 18), also known as HPRP18, is a 342 amino acid protein that localizes to nuclear speckles and plays a role in the second step of pre-mRNA splicing. A member of the PRP18 family, PRPF18 contains seven WD repeats and exists as two alternatively spliced isoforms which are encoded by a gene located on human chromosome 10p13. Chromosome 10 contains over 800 genes and 135 million nucleotides. PTEN is an important tumor suppressor gene located on chromosome 10 and, when defective, causes a genetic predisposition to cancer development known as Cowden syndrome. Other chromosome 10 associated disorders include Cockayne syndrome, tetrahydrobiopterin deficiency and trisomy 10.

Specifications

• Accession Number: Q99633
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8559
• Name: Human PRPF18 (aa 62-144) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2810441A10Rik; HPRP18; HPRP18 homolog; Kcrf; Potassium channel regulatory factor; Pprf18; pre-mRNA processing factor 18; pre-mRNA-splicing factor 18; Prp18; PRP18 homolog; PRP18 pre-mRNA processing factor 18 homolog; PRP18 pre-mRNA processing factor 18 homolog (yeast); PRP18 pre-mRNA processing factor 18 homolog(PRPF18); Prpf18
• Common Name: PRPF18
• Gene Symbol: PRPF18
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SNPVLELELAEEKLPMTLSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVNKGLRNDLKAALDKIDQQYLNEIVG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining