Invitrogen™ Human PRR14L (aa 1120-1213) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103461	100 μL

Catalog No. RP103461 Supplier Invitrogen™ Supplier No. RP103461

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64043. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The specific function of C22orf30 is not yet known.

Specifications

• Accession Number: Q5THK1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 253143
• Name: Human PRR14L (aa 1120-1213) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 6030436E02Rik; C22orf30; C330019G07Rik; Prl14l; proline rich 14 like; proline rich 14-like; proline rich 14-like protein; Protein PRR14L; PRR14L; RGD1305469
• Common Name: PRR14L
• Gene Symbol: PRR14L
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASTVDFLKIKKSCEENVCRSLKDCEMEKCPDSCAHEMESVADHEPNKRILGRVNLSLNDSHYGQQDKGTSLRETQEMTEGSRLEPNSEFGKEST
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining