Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human PRSS27 (aa 79-158) Control Fragment Recombinant Protein

Catalog No. RP108785
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108785 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108785 Supplier Invitrogen™ Supplier No. RP108785
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140309. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRSS27, also known as Marapsin, is a gene located on chromosome 16p13.3 that encodes a serine protease enzyme. This protein is part of the trypsin-like serine protease family, which is characterized by a catalytic triad essential for proteolytic activity. PRSS27 is primarily expressed in the epidermis and other epithelial tissues, such as the salivary glands and pancreas. It plays a role in various physiological processes, including digestion, inflammation, and immune response regulation. In the skin, PRSS27 is involved in keratinocyte differentiation and the maintenance of skin barrier function. Dysregulation or altered expression of PRSS27 has been associated with inflammatory skin conditions, such as psoriasis, where it may influence the inflammatory cascade and contribute to disease pathogenesis. Research into PRSS27 continues to explore its potential role in epithelial homeostasis and as a therapeutic target for skin-related and other inflammatory disorders.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BQR3
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 83886
Name Human PRSS27 (aa 79-158) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias CAP-2; CAPH2; channel-activating protease 2; channel-activating protease 2-like protein; EC 3.4.21; EC 3.4.21.4; EC 3.4.21.43; marapsin; Mpn; MPNMarapsin; Pancreasin; protease, serine 27; PRSS27; Serine protease 27; UNQ1884/PRO4327
Common Name PRSS27
Gene Symbol PRSS27
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.