Invitrogen™ Human PSMB4 (aa 17-98) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109353	100 μL

Catalog No. RP109353 Supplier Invitrogen™ Supplier No. RP109353

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Specifications

• Accession Number: P28070
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5692
• Name: Human PSMB4 (aa 17-98) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 26 kDa prosomal protein; HN3; HsBPROS26; HsN3; Lmp3; Low molecular mass protein 3; macropain beta chain; Multicatalytic endopeptidase complex beta chain; PROS26; PROS-26; Pros-27; proteasome (prosome, macropain) subunit, beta type 4; proteasome (prosome, macropain) subunit, beta type, 4; proteasome beta 4 subunit; proteasome beta chain; Proteasome chain 3; proteasome subunit beta 4; proteasome subunit beta type-4; proteasome subunit HsN3; proteasome subunit, beta type, 4; Psmb4; RN3; testis tissue sperm-binding protein Li 79P
• Common Name: PSMB4
• Gene Symbol: PSMB4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: APGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining