Invitrogen™ Human PSMB7 (aa 118-194) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92975	100 μL

Catalog No. RP92975 Supplier Invitrogen™ Supplier No. RP92975

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111352. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome. Expression of this catalytic subunit is downregulated by gamma interferon and proteolytic processing is required to generate a mature subunit. This subunit is not present in the immunoproteasome and is replaced by catalytic subunit 2i (proteasome beta 10 subunit).

Specifications

• Accession Number: Q99436
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5695
• Name: Human PSMB7 (aa 118-194) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AU020723; beta-type proteasome 7 subunit; EGK_07890; hypothetical protein LOC511207; macropain chain Z; MC14; Mmc14; Multicatalytic endopeptidase complex chain Z; proteasome (prosome, macropain) subunit, beta type 7; proteasome (prosome, macropain) subunit, beta type, 7; proteasome 20S subunit beta 7; proteasome beta 7 subunit; proteasome catalytic subunit 2; proteasome subunit alpha; proteasome subunit beta 7; proteasome subunit beta type-7; proteasome subunit beta type-7 proprotein; proteasome subunit Z; protein serine kinase c17; Psmb7; RP11-101K10.7; Z
• Common Name: PSMB7
• Gene Symbol: Psmb7
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining