Invitrogen™ Human PSME2 Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105235	100 μL

Catalog No. RP105235 Supplier Invitrogen™ Supplier No. RP105235

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signalling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Others are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (approximately 31), barrel-shaped molecular machine with an apparent molecular weight of approximately 2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. An enzymatic cascade is responsible for the attachment of multiple ubiquitin molecules to lysine residues of proteins targeted for degradation. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis, Angelman's syndrome, and Liddle syndrome.

Specifications

• Accession Number: Q9UL46
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5721
• Name: Human PSME2 Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 11S regulator complex beta subunit; 11S regulator complex subunit beta; AA589371; Activator of multicatalytic protease subunit 2; AI788882; cell migration-inducing protein 22; MCP activator, 31-kD subunit; PA28b; Pa28b1; PA28beta; protease (prosome, macropain) 28 subunit, beta; proteasome (prosome, macropain) 28 subunit, beta; proteasome (prosome, macropain) activator subunit 2; proteasome (prosome, macropain) activator subunit 2 (PA28 beta); proteasome activator 28 subunit beta; proteasome activator 28-beta; proteasome activator complex subunit 2; proteasome activator hPA28 subunit beta; proteasome activator subunit 2; Psme2; REGbeta; REG-beta
• Common Name: PSME2
• Gene Symbol: PSME2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining