Invitrogen™ Human PTGDS (aa 155-190) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109818	100 μL

Catalog No. RP109818 Supplier Invitrogen™ Supplier No. RP109818

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. PTGDS has also been implicated in the development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement (NREM) sleep. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system. PTGDS is the most abundant protein in the cerebral spinal fluid and recent evidence suggests that PTGDS acts as a Beta-Amyloid chaperone and may have a role in the deposition of Ab plaques in Alzheimer's disease.

Specifications

• Accession Number: P41222
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5730
• Name: Human PTGDS (aa 155-190) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 21kDa; Beta-trace protein; cerebrin-28; Glutathione-independent PGD synthase; glutathione-independent PGD synthetase; lipocalin-type prostaglandin D synthase; lipocalin-type prostaglandin-D synthase; LPGDS; L-PGDS; PDS; PGD2; PGD2 synthase; PGDS; PGDS2; PH2DISO; Prostaglandin D synthase; prostaglandin D2 synthase; prostaglandin D2 synthase (21 kDa, brain); prostaglandin D2 synthase (brain); prostaglandin D2 synthase 21kDa (brain); prostaglandin-D2 synthase; Prostaglandin-H2 D-isomerase; Ptgds; Ptgs3; testis tissue sperm-binding protein Li 63n
• Common Name: PGD2
• Gene Symbol: PTGDS
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining