Invitrogen™ Human PTGES2 (aa 82-160) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104567	100 μL

Catalog No. RP104567 Supplier Invitrogen™ Supplier No. RP104567

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64984. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The PTGES2 gene encodes for the enzyme prostaglandin E synthase 2 (PTGES2), which is crucial for the biosynthesis of prostaglandin E2 (PGE2) from arachidonic acid. This enzyme operates downstream of the cyclooxygenase (COX) pathway, particularly interacting with COX-1 and COX-2 enzymes. PTGES2 is involved in various physiological and pathological processes by generating PGE2, which functions in inflammation, fever generation, and pain. Notably, PTGES2 is a membrane-associated protein and is distinct in its role compared to other prostaglandin synthases due to its specific functional and regulatory properties. Its activity is essential in fine-tuning the levels of PGE2 in tissues, impacting numerous signaling cascades, including those involved in immune responses and vascular functions.

Specifications

• Accession Number: Q9H7Z7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 80142
• Name: Human PTGES2 (aa 82-160) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0610038H10Rik; C79137; C9orf15; FLJ14038; gamma-interferon-activated transcriptional element-binding factor 1; GATE-binding factor 1; Gbf1; GBF-1; membrane-associated prostaglandin E synthase 2; membrane-associated prostaglandin E synthase-2; MGC11289; Microsomal prostaglandin E synthase 2; microsomal prostaglandin E synthase-2; mPGE synthase-2; Mpges2; mPGES-2; PGES2; Prostaglandin E synthase 2; Prostaglandin E synthase 2 truncated form; Prostaglandin-H(2) E-isomerase; PTGES2; RP11-395P17.2
• Common Name: PTGES2
• Gene Symbol: Ptges2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining