Invitrogen™ Human PTRF (aa 117-204) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107984	100 μL

Catalog No. RP107984 Supplier Invitrogen™ Supplier No. RP107984

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84948. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The polymerase I and transcript release factor (PTRF) enables the dissociation of paused ternary polymerase I transcription complexes from the 3' end of pre-rRNA transcripts, regulating rRNA transcription by promoting the dissociation of transcription complexes and the re-initiation of polymerase I on nascent rRNA transcripts. PTRF also localizes to caveolae at the plasma membrane and is thought to play a critical role in the formation of caveolae and the stabilization of caveolins, translocating from caveolae to the cytoplasm after insulin stimulation. PTRF is also thought to modify lipid metabolism and insulin-regulated gene expression. Mutations in this gene result in a disorder characterized by generalized lipodystrophy and muscular dystrophy.

Specifications

• Accession Number: Q6NZI2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 284119
• Name: Human PTRF (aa 117-204) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310075E07Rik; AW546441; caveolae associated protein 1; caveolae-associated protein 1; CAVIN; CAVIN1; cavin-1; Cav-p60; CGL4; FKSG13; FLJ90031; Polymerase I and transcript release factor; PTRF; ptrf {ECO:0000312; RGD:1307685}; RNA polymerase I and transcript release factor; TTF-I interacting peptide 12
• Common Name: PTRF
• Gene Symbol: CAVIN1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining