Invitrogen™ Human PYGO1 (aa 105-247) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89401	100 μL

Catalog No. RP89401 Supplier Invitrogen™ Supplier No. RP89401

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59927. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pygopus 1 (PYGO1) is a gene located on chromosome 6p21.31, encoding a protein that plays a crucial role in the Wnt signaling pathway, which is fundamental for various developmental processes including cell proliferation, polarity, and fate determination. PYGO1 is a part of the Pygopus family of proteins, characterized by their Plant Homeodomain (PHD) finger domain that facilitates interaction with histones. Within the Wnt signaling pathway, PYGO1 acts as a coactivator by binding to components of the transcription complex, thus aiding in the expression of Wnt target genes. The protein is especially important in embryonic development and is implicated in specific processes such as limb formation and neural development. Dysregulation of PYGO1 and the Wnt pathway is associated with developmental disorders and certain cancers, demonstrating the protein's significance in maintaining cellular homeostasis. Current studies are focusing on the mechanistic aspects of PYGO1's function in transcription regulation and its potential role in therapeutic strategies targeting Wnt signaling-related diseases.

Specifications

• Accession Number: Q9Y3Y4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 26108
• Name: Human PYGO1 (aa 105-247) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2600014C22Rik; PYGO1; pygopus 1; pygopus family PHD finger 1; pygopus homolog 1; pygopus-like protein 1; zgc:172214
• Common Name: PYGO1
• Gene Symbol: PYGO1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGFNRPHAFNFGPHDNSSFGNPSYNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDLASNFVPGNNSNFTSPLESNHSFIPPPNTFGQAKAPPPKQDFTQGATK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining