Invitrogen™ Human RAB41 Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92007	100 μL

Catalog No. RP92007 Supplier Invitrogen™ Supplier No. RP92007

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51592. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Rab 41 (Ras-related protein Rab-41) is a 222 amino acid protein that belongs to the small GTPase superfamily and the Rab family.Members of the Rab familyfunction asregulators ofmembrane trafficking. They cycle between inactive GDP-bound and activated GTP-bound states, which is controlled by GTP hydrolysis-activating proteins (GAPs). Rab 41 can be activated by the GAP protein RN-Tre. Localizing to the Golgi complex, Rab 41 is involved in protein transport and participates in GTP binding. Existing as two alternatively spliced isoforms, the gene that encodes the Rab 41 protein maps to human chromosome Xq13.1. Chromosome X consists of about 153 million base pairs and nearly 1,000 genes. Color blindness, hemophilia, and Duchenne muscular dystrophy are well known X chromosome-linked conditions which affect males more frequently as males carry a single X chromosome.

Specifications

• Accession Number: Q5JT25
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 347517
• Name: Human RAB41 Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: RAB41; RAB41, member RAS homolog family; RAB41, member RAS oncogene family; ras-related protein Rab-41
• Common Name: RAB41
• Gene Symbol: RAB41
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GKTSIISRFMYNSFGCACQATVGIDFLSKTMYLEDQIVQLQLWDTAGQERFHSLIPSYIRDSTIAVVVYDITNINSFKETDKWVEHVRAERGDDVVIMLLGNKIDLDNKRQVTAEQGEEKSRNLNVMFIETSAKTGYNVKKVI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining