Invitrogen™ Human RAG2 (aa 94-187) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108511	100 μL

Catalog No. RP108511 Supplier Invitrogen™ Supplier No. RP108511

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111605. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RAG2 (V(D)J recombination-activating protein 2) is a core component of the RAG complex - a multiprotein complex that mediates the DNA cleavage phase during V(D)J recombination. V(D)J recombination assembles a diverse repertoire of immunoglobulin and T-cell receptor genes in developing B and T-lymphocytes through rearrangement of different V (variable), in some cases D (diversity) and J (joining) gene segments. DNA cleavage by the RAG complex occurs in 2 steps: 1) first a nick is introduced in the top strand immediately upstream of the heptamer, generating a 3'-hydroxyl group that can attack the phosphodiester bond on the opposite strand in a direct transesterification reaction, thereby creating 4 DNA ends. 2) hairpin coding ends and 2 blunt, 5'-phosphorylated ends are created. The chromatin structure plays an essential rold in the V(D)J recombination reactions and the presence of histone H3 trimethylated at 'Lys-4' (H3K4me3) stimulates both the nicking and hair pinning expressed on individual B-lymphocytes. The introduction of DNA breaks by the RAG complex on one immunoglobulin allele induces ATM-dependent repositioning of the other allele to pericentromeric heterochromatin. This prevents accessibility to the RAG complex and recombination of the second allele. In the RAG complex, RAG2 is not the catalytic component but is required for all known catalytic activities mediated by RAG1. Mutations affecting the gene can results in combined cellular and humoral immune defects with granulomas, severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-negative/NK-cell-positive, and Omenn syndrome.

Specifications

• Accession Number: P55895
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5897
• Name: Human RAG2 (aa 94-187) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: RAG 2; Rag2; RAG-2; recombinase activating gene 2; recombination activating gene 2; recombination activating protein 2; V(D)J recombination-activating protein 2
• Common Name: RAG2
• Gene Symbol: RAG2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HGGKTPNNEVSDKIYVMSIVCKNNKKVTFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGVLFGGRSYMPSTHRTTEKWNSVADCLPCVFLVDF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining