Invitrogen™ Human RAP (aa 55-182) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102336	100 μL

Catalog No. RP102336 Supplier Invitrogen™ Supplier No. RP102336

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82324. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The term RAP typically refers to receptor-associated protein, encoded by the LRPAP1 gene, which plays a significant role in the trafficking and function of certain receptors within cells. RAP is primarily involved in the regulation of low-density lipoprotein receptor-related proteins (LRPs) by acting as a chaperone during protein transport within the endoplasmic reticulum (ER). It prevents premature ligand binding and assists in the proper folding and assembly of receptor complexes, ensuring efficient receptor function and trafficking to the cell surface. RAP also influences cellular processes related to cholesterol metabolism and cell signaling through its interactions with these receptors. Its function is crucial for transporting and recycling receptors involved in various pathways, including lipid metabolism, endocytosis, and cellular homeostasis. Dysregulation of RAP or related receptor functions can impact metabolic health and are implicated in conditions such as atherosclerosis, neurodegenerative disorders, and cancer.

Specifications

• Accession Number: P30533
• Concentration: 3.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4043
• Name: Human RAP (aa 55-182) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 39 kDa receptor-associated protein; A2MRAP; A2RAP; AA617339; AI790446; Alpha-2-macroglobulin receptor-associated protein; Alpha-2-macroglobulin receptor-associated protein precursor (Alpha-2-MRAP) (Low density lipoprotein receptor-related protein-associated protein 1) (RAP) (Heparin binding protein-44) (HBP-44); alpha-2-MRAP; AU042172; C77774; gp330-binding 45 kDa protein; HBP44; HBP-44; heparin-binding protein 44; LDL receptor related protein associated protein 1; low density lipoprotein receptor related protein, associated protein 1; low density lipoprotein receptor-related protein associated protein 1; low density lipoprotein receptor-related protein-associated protein 1; low density lipoprotein-related protein-associated protein 1 (alpha-2-macroglobulin receptor-associated protein 1); Lrpap1; MRAP; MYP23; RAP
• Common Name: RAP
• Gene Symbol: Lrpap1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining