Invitrogen™ Human RARS (aa 443-584) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102262	100 μL

Catalog No. RP102262 Supplier Invitrogen™ Supplier No. RP102262

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52057. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The fidelity of protein synthesis requires efficient discrimination of amino acid substrates by aminoacyl-tRNA synthetases. ArgRS (Arginyl-tRNA synthetase), also known as RARS or DALRD1, belongs to the class-I aminoacyl-tRNA synthetase family that includes the related proteins, LeuRS, ValRS and IleRS. These proteins are large monomeric proteins and play a major role in catalyzing the aminoacylation of tRNA by their cognate amino acid. ArgRS localizes to the cytoplasm and exists as a monomer but can also associate with other tRNA synthetases and auxiliary proteins to form a multisubunit complex. In the presence of ATP, arginine (Arg) and tRNA, ArgRS joins Arg to tRNA(Arg) at its synthetic active site. Two cytoplasmic forms of ArgRS have been described in mammals, differing by the addition of a 73 amino acid sequence that is required for ArgRS assembly into the multisubunit complex.

Specifications

• Accession Number: P54136
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5917
• Name: Human RARS (aa 443-584) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2610011N19Rik; 2610037E21Rik; AL033339; arginine tRNA ligase 1, cytoplasmic; arginine--tRNA ligase, cytoplasmic; Arginyl-tRNA synthetase; arginyl-tRNA synthetase, cytoplasmic; argRS; AW985894; DALRD1; HLD9; MGC8641; RARS
• Common Name: RARS
• Gene Symbol: RARS1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEELNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARLANIDEEMLQKAARETKILLDHEKEWKLGRCILRFPEI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining