Invitrogen™ Human Rbm20 (aa 667-757) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP97212	100 μL

Catalog No. RP97212 Supplier Invitrogen™ Supplier No. RP97212

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58068. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that likely binds RNA. Mutations in this gene have been associated with familial dilated cardiomyopathy.

Specifications

• Accession Number: Q5T481
• Concentration: 1.10 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 282996
• Name: Human Rbm20 (aa 667-757) Control Fragment
• pH Range: 7.4
• Purification Method: Metal-chelate chromatography
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110018J23Rik; 2010003H22Rik; AI646761; probable RNA-binding protein 20; Rbm20; RNA binding motif protein 20; RNA-binding motif protein 20; RNA-binding protein 20
• Common Name: Rbm20
• Gene Symbol: Rbm20
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ADWGNGRDSWEHSPYARREEERDPAPWRDNGDDKRDRMDPWAHDRKHHPRQLDKAELDERPEGGRPHREKYPRSGSPNLPHSVSSYKSRED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining